PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P13050_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 781aa    MW: 85197.9 Da    PI: 6.3461
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P13050_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-182582457
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                             ++t+eq+e+Le++++++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr2P13050_001 25 YVRYTPEQVEALERVYNECPKPSSLKRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 82
                           6789****************************************************97 PP

2START1693.1e-531723802205
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++  v+e+l+d++ W ++++  ++l vi  g 
  GSMUA_Achr2P13050_001 172 IAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPT-KVAEILKDRPSWYRDCRCLDVLTVIPAGn 258
                            68999*****************************************************.8888888888****************999 PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g ++l++++++a+++l+  Rdf+++Ry+  l++g++vi+++S+++ +  p     +++vRae+lpSg+li+p+++g+s +++v+hvd
  GSMUA_Achr2P13050_001 259 gGNIELIYMQTYAPTTLAVaRDFWTLRYTTALEDGSLVICERSLTPATGGPAgppAPNFVRAEMLPSGYLIRPCEGGGSMIHIVDHVD 346
                            9**************99988***************************99998889********************************* PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                            l+ ++++++lr+l++s  + ++kt+ a+l+++++
  GSMUA_Achr2P13050_001 347 LDPWSVPEVLRPLYESPKILAQKTTIAALRYLTQ 380
                            *****************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-18782IPR009057Homeodomain-like
PROSITE profilePS5007115.4671983IPR001356Homeobox domain
SMARTSM003895.1E-152187IPR001356Homeobox domain
CDDcd000861.21E-162484No hitNo description
SuperFamilySSF466891.15E-162486IPR009057Homeodomain-like
PfamPF000462.7E-162582IPR001356Homeobox domain
CDDcd146861.62E-676115No hitNo description
PROSITE profilePS5084825.657162390IPR002913START domain
CDDcd088751.21E-69166382No hitNo description
Gene3DG3DSA:3.30.530.201.7E-23170354IPR023393START-like domain
SMARTSM002349.6E-47171381IPR002913START domain
SuperFamilySSF559612.47E-38172383No hitNo description
PfamPF018524.4E-51172380IPR002913START domain
PfamPF086703.5E-10709757IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MAMVVSGKEA GKGQQQAAAM EAGKYVRYTP EQVEALERVY NECPKPSSLK RQQLIRECPI  60
LSNIEPKQIK VWFQNRRCRE KQRKEASRLQ TVNRKLTAMN KLLMEENDRL QKQVSHLVYE  120
NGYMRQQLHN PSVATTDTSC ESVVTSGQHH HQQNPTPQHP QRDANPAGLL AIAEETLAEF  180
LSKATGTAVD WVQMVGMKPG PDSIGIIAVS HNCSGVAARA CGLVSLEPTK VAEILKDRPS  240
WYRDCRCLDV LTVIPAGNGG NIELIYMQTY APTTLAVARD FWTLRYTTAL EDGSLVICER  300
SLTPATGGPA GPPAPNFVRA EMLPSGYLIR PCEGGGSMIH IVDHVDLDPW SVPEVLRPLY  360
ESPKILAQKT TIAALRYLTQ IAQEISGEVP YGGGRQPAVL RAFSQRLSRG FNDAVNGFSD  420
DGWSLLGSDG VEDVTIAINS SPNKLLGSHA NPSALYSTLG GGILCAKASM LLQNVPPAIL  480
VRFLREHRSE WADCGVDAYS AASLRANPYA VPGVRASTGF SGSQVILPLA HTAEHEEFLE  540
VIRLEGHGFN QDDVILSRDM YMLQLCSGVD ESAVGACAQL VFAPIDESFD DDLPLLPSGF  600
RVIPLDPKTD SPATTRTLDL ASMLEIGSGA TARSVNETAS STYNLRSVLT IAFQFTYENH  660
LRDNVAAMAR QYVRSVVASV QRVAMAIAPS RPGCQIGVKH PPGSPEAHTL AQWISRSYRA  720
HSGVELFQVD LQANDSLLKL LWHHPDAVMC CSLKASDTTY LYTFLTCAMI DNLSDTDAVN  780
T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009388964.10.0PREDICTED: homeobox-leucine zipper protein HOX32-like
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLM0S7J60.0M0S7J6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P13050_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein